PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00919.1.g00160.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ERF
Protein Properties Length: 463aa    MW: 47902.9 Da    PI: 6.9744
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00919.1.g00160.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP238.52.9e-123384153
                           AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkl 53
                                  ++y GVr  ++ +++ A Irdps+++  kr +lg+++taeeAa a++aa + l
  Zpz_sc00919.1.g00160.1.am.mk 33 KKYIGVR-SRYGNKFGADIRDPSSGNAAKRLWLGTYDTAEEAACAHDAAVRTL 84
                                  59****9.7789*********9985436*********************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000181.02E-163395No hitNo description
SuperFamilySSF541712.03E-123494IPR016177DNA-binding domain
PROSITE profilePS5103215.6333493IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.105.1E-193494IPR001471AP2/ERF domain
SMARTSM003802.6E-143499IPR001471AP2/ERF domain
PfamPF008471.3E-43480IPR001471AP2/ERF domain
PRINTSPR003678.5E-53546IPR001471AP2/ERF domain
PRINTSPR003678.5E-56076IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MEGGLTGYAK AAAAAKIKAD REAQGREPSS PGKKYIGVRS RYGNKFGADI RDPSSGNAAK  60
RLWLGTYDTA EEAACAHDAA VRTLNPNSRT NFPDLGEKEE RDAVVHAHLA KTKRKLADKL  120
ARVADGKMEA AESALAGARD IVSALPAPPP SPAPAGDVVD LTDSPTGSPG EDDAVAALEM  180
LQGQGQAPEP VASSVSPAPP PPSVPHFAPS PVSEAFNSND NLTQAASGGA SVAQNTPVLA  240
LPALVNSFFP SPHAMALPPP PGFPFAPIFD PPPLASHFPP RWIARPPGFH LAPAPTAPAT  300
EAVVTSTPSP STMAPVGGAS APNFASFWGP VAAPPANNPP HTTAPPPGFH PAPASATTAL  360
PITPETWEFL YQYHAALSPV QAQHHLKILR ELLPLSSFGP AIMNTDASSS AAPAISESQP  420
EVEAFRKLYR LLEKQAAGAP VDATVYDPGK QDGRRKKKRS GGA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1453458RRKKKR
2453459RRKKKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1971958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46768.14e-08related to AP2 1